Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEDRPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISRADDDDDSPSPDAEAFAAYLAYLYSYWKTPEYSQFLTHPGPTLRALRLLQEDNFRRDIILPQVIEGLAGVSVPEPAQTETDTADEKQQDGQNGKT |
Length | 137 |
Position | Middle |
Organism | Penicillium italicum (Blue mold) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.550 |
Instability index | 48.66 |
Isoelectric point | 4.32 |
Molecular weight | 15396.81 |
Publications | PubMed=25338147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02181 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 161.94| 50| 76| 5| 56| 1 --------------------------------------------------------------------------- 5- 56 (82.59/55.13) PTLTNPRFTLELEFVSSLANPYYLSHLA.VTYPNllGISRADDDDDSPSPDAE 83- 133 (79.36/47.62) PTLRALRLLQEDNFRRDIILPQVIEGLAgVSVPE..PAQTETDTADEKQQDGQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FRRDII 2) TYPNLLGISRADDDDDSPSPDAEAFAAYLAYLYSYWKTPEYSQFLT | 96 34 | 101 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab