<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02162
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSASEQSHAANFISSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSFPTPASSVSGNPANATSDEMDQGRKSFNLGIQDSAENSGARPAQQPTQQSTEHRPTDHDRQSSQTDSNNNFATGQDQHSTDPDAMDVDTEPSRRADTLRLDLDSLQKELTSAFHLCKSTEVVNTAFYSLTAPIVTGPDPSVDLISLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPLKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDFWEDILGHEKQAKNPAPGETGKKAAPAPIAGRPSTQSYAPSPRPQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLYSYGQ |
| Length | 404 |
| Position | Head |
| Organism | Penicillium italicum (Blue mold) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.959 |
| Instability index | 54.85 |
| Isoelectric point | 5.96 |
| Molecular weight | 43865.57 |
| Publications | PubMed=25338147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02162
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.83| 11| 15| 363| 373| 1
---------------------------------------------------------------------------
363- 373 (22.39/11.80) DDNSFAGYGEG
379- 389 (23.44/12.64) DDPGFYSNGEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.59| 29| 52| 28| 56| 2
---------------------------------------------------------------------------
28- 56 (51.08/27.91) NISSPPSSAPMSTQVSQQPTMSTTNSFPT
81- 109 (48.51/26.12) NLGIQDSAENSGARPAQQPTQQSTEHRPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.41| 14| 19| 179| 192| 4
---------------------------------------------------------------------------
179- 192 (27.12/15.21) FYSL..TAPIVTGPDP
199- 214 (21.29/10.65) LYGLgsIAHSVARMDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.15| 20| 21| 229| 248| 6
---------------------------------------------------------------------------
229- 248 (33.28/21.63) GKLKGLGLAGRNKPLKQEI.G
251- 271 (33.87/22.14) GSLRYMTLWPEEEWQNQKVhG
---------------------------------------------------------------------------
|