Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSASEQSHAANFISSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTTNSFPTPASSVSGNPANATSDEMDQGRKSFNLGIQDSAENSGARPAQQPTQQSTEHRPTDHDRQSSQTDSNNNFATGQDQHSTDPDAMDVDTEPSRRADTLRLDLDSLQKELTSAFHLCKSTEVVNTAFYSLTAPIVTGPDPSVDLISLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPLKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQSRAMQMEPGPIPNNDFWEDILGHEKQAKNPAPGETGKKAAPAPIAGRPSTQSYAPSPRPQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLYSYGQ |
Length | 404 |
Position | Head |
Organism | Penicillium italicum (Blue mold) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.959 |
Instability index | 54.85 |
Isoelectric point | 5.96 |
Molecular weight | 43865.57 |
Publications | PubMed=25338147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02162 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.83| 11| 15| 363| 373| 1 --------------------------------------------------------------------------- 363- 373 (22.39/11.80) DDNSFAGYGEG 379- 389 (23.44/12.64) DDPGFYSNGEG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 99.59| 29| 52| 28| 56| 2 --------------------------------------------------------------------------- 28- 56 (51.08/27.91) NISSPPSSAPMSTQVSQQPTMSTTNSFPT 81- 109 (48.51/26.12) NLGIQDSAENSGARPAQQPTQQSTEHRPT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.41| 14| 19| 179| 192| 4 --------------------------------------------------------------------------- 179- 192 (27.12/15.21) FYSL..TAPIVTGPDP 199- 214 (21.29/10.65) LYGLgsIAHSVARMDP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.15| 20| 21| 229| 248| 6 --------------------------------------------------------------------------- 229- 248 (33.28/21.63) GKLKGLGLAGRNKPLKQEI.G 251- 271 (33.87/22.14) GSLRYMTLWPEEEWQNQKVhG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWEDILGHE 2) KRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLYSYGQ | 303 359 | 311 404 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab