<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02161
| Description |
"Mediator complex, subunit Med21" |
| Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTTPPPNVPNAVPALAKITKNSSSPPVPAAIANKVGGAAAVAGNASPPHAPPQQPGAAPGTALQGDDPNLPPAPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQETRIRELEIELRDVEKERAAKVRELKKLRTRLEDVLGAVAVGIHGDGYPSK |
| Length | 199 |
| Position | Middle |
| Organism | Penicillium expansum (Blue mold rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.346 |
| Instability index | 60.58 |
| Isoelectric point | 5.42 |
| Molecular weight | 21065.56 |
| Publications | PubMed=25338147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02161
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.71| 20| 21| 69| 88| 1
---------------------------------------------------------------------------
46- 68 (24.79/ 7.78) PALAKITKNSSSPPVPaaiANKV
69- 88 (37.33/14.63) GGAAAVAGNASPPHAP...PQQP
89- 110 (29.60/10.41) GAAPGTALQGDDPNLP.paPDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.06| 13| 15| 147| 160| 2
---------------------------------------------------------------------------
147- 160 (17.30/18.77) EQETRIRELEiELR
165- 177 (20.76/16.02) ERAAKVRELK.KLR
---------------------------------------------------------------------------
|