<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02160

Description "Mediator complex, subunit Med12"
SequenceMIPHSSAGGQPWGQPLRTFNGGPGRVDNAQMLGQYDQPDRSASLPQPPIRQPVVVDLTAGGPESQDREPPPKRPRLEVPSGSNTSDTGAVVGETRNTPGSAISRPAVSWRGRPAWSFQAVVSEIPSNENRGDGAAGSKPSSPPPLPAQPWVNYFGTEPEGNGVVKSRESSPVGAVQTTPYCIEIPSVAPVYKSQKPADFAPWTGNHPEDVLSEQTAKQGYYDRTQVSQNESNTARPALYAQLKNRTGLQMLSSVFAAALEKRQTHNTIHAPSTFKPPPRVTLTDNKREAWLRDLANPSVPLRRLSRTIPHGIRGKILLDQCLGKWIPVARAVWLAKCVGANEIRAFKRKGTSGALAVGLEAKWVREWTTNVQQFVEGVFAAPKSSDWKAKMTYAVGLTARLFSENLLDHDHFLEWFLSSFEAASIGTIPVWLLMLGIYWTSIMRYRRRGRRLAELLLQKMRQATEAKLTQLQPLIDRLSRFIKKLVLDHTSSMILPNSWETYKQQVLSALDLSNEAEKALFQSLAERNARVQRPKHSKQTTQRSPHQRIVRLLDSIRTAQDLSSVFGYLDAFDDKAVLVFKLLEWLSTPFRHGLCRVYIGVRLLRKWKLAGIDIDSHILAFLSRGQNNQKLNMDQIYHVVSELVRSQTFSVGRYLQWLMARGVTNGSSSAEERKVQDLPIDIALIAQLPVARLPEHVGNLRSTLLTRTGLSASEENATIDSVKDIISQRLPGIFGVHESASMALDSLPQNLPWAVKAEVGQWLRKAIAEHNRGTESTNREAFPVGIPSVVSALTPVEFYTVRDALETFDDISMLADVLKFASSCGDSTVLASVADTTNCHFNSLCVIGATTDLFRRLIDAYAGIKRYGMPSLDLIFSLIELGLRIPTELNTVSILRQDLSRMENKSIMAASSPVSDHIPDGFGGVDPFFREKLDQLLQSGNVMDEPTLDAIFNTLIKHLESDDGHANLSANDTCRYLAQLRSFHPKHFDGILARWVCGHLRSPERTILLRILPPLIGVGCVTIRAFLALAKRLTLSTPTTVPNAAQLPADLVQLLVSGDEDSKSFDLVSYRFQLAQQEFLNKNSEEALKIVCDAASSNASGSSAGRSELEHSIIMLLRDLLVRHPECAAQNGMQKLMDQYPAALSIVQKALDLLLGVDSQSDDNSVLSKVEKLACMTDDFSLPFCQLKLQVLFHADSGSEDRTNIVDAMFKTAVSDCRAHRLHWVDLVALMTPDAVRQIRERAEKAFFSIPLLEEPIGDIPDSPDKLGSLETAKMYLTIIEELASSIPDSGAPSVAPVLVEKMDSLLHKIITMHNSTIAKGVTNTDRPKFERALAFWFSALLRIIVLHRSAFSQPPPSLKVNPLHEQLRLLTSIFCIALSRLPGDVLRLFPAADYFPHPTPTEGFRPCPGILLQTHALDVAASLIDIFPDDVRHQCARFLKEKCPSFVPFQNDSRFLYLLGPMTDHSANAQQVSAPSPAASGSTPTPTPAIFSIAGSSSAQQSVAAASGLSTGLPDTNSMANRLRLQHRGRVVGPYPVRPWELLEDAAPFLGVNDTAVNLGFFDARRVRA
Length1570
PositionKinase
OrganismPenicillium expansum (Blue mold rot fungus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
Aromaticity0.07
Grand average of hydropathy-0.180
Instability index45.62
Isoelectric point8.42
Molecular weight173118.87
Publications
PubMed=25338147

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02160
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.95|      18|      39|     346|     366|       1
---------------------------------------------------------------------------
  346-  366 (27.53/28.01)	FKRKGTsgaLAVGLEAKWVRE
  387-  404 (33.43/23.56)	WKAKMT...YAVGLTARLFSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.87|      33|      36|    1283|    1316|       2
---------------------------------------------------------------------------
 1283- 1316 (50.11/48.82)	LASSIPDSGAPSVAPVLVEKMDSLLhKIITMHNS
 1318- 1350 (55.76/47.55)	IAKGVTNTDRPKFERALAFWFSALL.RIIVLHRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.13|      20|      36|    1144|    1163|       3
---------------------------------------------------------------------------
 1144- 1163 (32.51/24.28)	LSIVQKALDLLLGVDSQSDD
 1182- 1201 (36.62/28.48)	LPFCQLKLQVLFHADSGSED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.46|      15|     279|     231|     245|       4
---------------------------------------------------------------------------
  231-  245 (26.51/19.24)	SNTARPALYAQLKNR
  513-  527 (24.95/17.62)	SNEAEKALFQSLAER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.99|      17|     131|     128|     144|       6
---------------------------------------------------------------------------
   82-  103 (20.69/ 7.35)	SNTSDtgavvGETRNTPGSAIS
  128-  144 (32.30/15.48)	ENRGD.....GAAGSKPSSPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.79|      32|      36|     722|     757|       7
---------------------------------------------------------------------------
  726-  757 (55.35/38.38)	ISQRLPGIFGVHE..SASMALDSLPQNLPWAVKA
  759-  792 (49.45/24.85)	VGQWLRKAIAEHNrgTESTNREAFPVGIPSVVSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.29|      17|     135|      10|      26|       8
---------------------------------------------------------------------------
   10-   26 (35.63/21.08)	QPWGQPLRTFNGGPGRV
  148-  164 (34.66/20.30)	QPWVNYFGTEPEGNGVV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02160 with Med12 domain of Kingdom Fungi
Unable to open file!