Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADENQQRAVNTAFAPPPPLWKHFTRENIDRVEQIKAEASKSEDGRLNKNKQWSAAELRALQLPSELRYLVPPDIPEGQYSVFGELQTLSTTLPSLQEQGIEQLYPEPPAAGTEQNSQPSPPLNHAYYLLKISKSLLLNFLEFTGILSVSPEQFESKVEDLRNLFINAHHLLNLYRPHQARESLIMMMEEQLNHSREEMKQMDKVKAEIESVLEQLQAEGSRVSGTGSEDDTDQAKALREKTDEHSRLIWDLLDKEN |
Length | 257 |
Position | Middle |
Organism | Penicillium expansum (Blue mold rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.732 |
Instability index | 58.84 |
Isoelectric point | 4.95 |
Molecular weight | 29371.58 |
Publications | PubMed=25338147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02154 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.04| 25| 179| 26| 59| 1 --------------------------------------------------------------------------- 33- 59 (36.67/40.41) EQIKAEASK.SEDGRLNKNKQwsAAELR 214- 239 (38.37/18.53) EQLQAEGSRvSGTGSEDDTDQ..AKALR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.89| 18| 43| 90| 107| 4 --------------------------------------------------------------------------- 90- 107 (31.84/22.73) STTLPSLQEQGIEQLYPE 135- 152 (30.05/21.06) SLLLNFLEFTGILSVSPE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKALREKTDEHSRLIWDLLDKE 2) PLWKHFTRENIDRV | 235 19 | 256 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab