<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02154
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADENQQRAVNTAFAPPPPLWKHFTRENIDRVEQIKAEASKSEDGRLNKNKQWSAAELRALQLPSELRYLVPPDIPEGQYSVFGELQTLSTTLPSLQEQGIEQLYPEPPAAGTEQNSQPSPPLNHAYYLLKISKSLLLNFLEFTGILSVSPEQFESKVEDLRNLFINAHHLLNLYRPHQARESLIMMMEEQLNHSREEMKQMDKVKAEIESVLEQLQAEGSRVSGTGSEDDTDQAKALREKTDEHSRLIWDLLDKEN |
| Length | 257 |
| Position | Middle |
| Organism | Penicillium expansum (Blue mold rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.732 |
| Instability index | 58.84 |
| Isoelectric point | 4.95 |
| Molecular weight | 29371.58 |
| Publications | PubMed=25338147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02154
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.04| 25| 179| 26| 59| 1
---------------------------------------------------------------------------
33- 59 (36.67/40.41) EQIKAEASK.SEDGRLNKNKQwsAAELR
214- 239 (38.37/18.53) EQLQAEGSRvSGTGSEDDTDQ..AKALR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.89| 18| 43| 90| 107| 4
---------------------------------------------------------------------------
90- 107 (31.84/22.73) STTLPSLQEQGIEQLYPE
135- 152 (30.05/21.06) SLLLNFLEFTGILSVSPE
---------------------------------------------------------------------------
|