Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSVSEQSHAANFISSHTSPNQATVQPSNISSPPSSTPMSTQVSQQPTMSTTNSFPTPASSVSGNPANATSEDVDQGRKSFNMGIQDSAEISGARPAQQPTQHRPTDHDRQSSQTESNNNFATGQGQHSTDPDAMDVDTEPTRRADTLSLDLDSLQKELTSAFHLCKSTEVVNTAFYSLTAPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPLKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQLRAMQMEPGPIPNNDFWEDILGHEKQAKNPAPGETGKKAALAPTAGRPSTQSYAASPRSQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLHSHGQ |
Length | 400 |
Position | Head |
Organism | Penicillium expansum (Blue mold rot fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.895 |
Instability index | 50.11 |
Isoelectric point | 6.19 |
Molecular weight | 43282.02 |
Publications | PubMed=25338147 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02151 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 124.15| 35| 39| 98| 134| 1 --------------------------------------------------------------------------- 45- 85 (27.14/ 7.31) ............QPtmstTNSFPTP....ASSVSGNPANATSedvdQGRKSFNmgiQ 86- 131 (51.28/22.79) DSAeisgarpaqQP....TQHRPTDhdRQSSQTESNNNFATG....QGQHSTD...P 336- 373 (45.74/15.91) YAA....sprsqEA....ERPRPS...RGRKRHYDDNSFA.G....YGEGFVD...D --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.92| 25| 38| 138| 163| 2 --------------------------------------------------------------------------- 138- 163 (38.38/30.93) TEPTRRADTLSLDLDSLQKeLTSAFH 179- 203 (44.53/31.04) TAPIVTGPDPSVDLVSLYG.LGSIAH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWEDIL 2) KRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLHSHGQ | 299 355 | 304 400 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab