<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02151
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSVSEQSHAANFISSHTSPNQATVQPSNISSPPSSTPMSTQVSQQPTMSTTNSFPTPASSVSGNPANATSEDVDQGRKSFNMGIQDSAEISGARPAQQPTQHRPTDHDRQSSQTESNNNFATGQGQHSTDPDAMDVDTEPTRRADTLSLDLDSLQKELTSAFHLCKSTEVVNTAFYSLTAPIVTGPDPSVDLVSLYGLGSIAHSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPLKQEIGAPGSLRYMTLWPEEEWQNQKVHGKAIKVSDMDSALQNLQLRAMQMEPGPIPNNDFWEDILGHEKQAKNPAPGETGKKAALAPTAGRPSTQSYAASPRSQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLHSHGQ |
| Length | 400 |
| Position | Head |
| Organism | Penicillium expansum (Blue mold rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.895 |
| Instability index | 50.11 |
| Isoelectric point | 6.19 |
| Molecular weight | 43282.02 |
| Publications | PubMed=25338147
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02151
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 124.15| 35| 39| 98| 134| 1
---------------------------------------------------------------------------
45- 85 (27.14/ 7.31) ............QPtmstTNSFPTP....ASSVSGNPANATSedvdQGRKSFNmgiQ
86- 131 (51.28/22.79) DSAeisgarpaqQP....TQHRPTDhdRQSSQTESNNNFATG....QGQHSTD...P
336- 373 (45.74/15.91) YAA....sprsqEA....ERPRPS...RGRKRHYDDNSFA.G....YGEGFVD...D
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.92| 25| 38| 138| 163| 2
---------------------------------------------------------------------------
138- 163 (38.38/30.93) TEPTRRADTLSLDLDSLQKeLTSAFH
179- 203 (44.53/31.04) TAPIVTGPDPSVDLVSLYG.LGSIAH
---------------------------------------------------------------------------
|