<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02134

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMDKFIDARFERLEKALTGLIDSVAKYHPSMNVADELKAADLELTRGLGKVETHQNNHLRILQLREASTALDTQIRETLTSLASTRNDIVNTQITTFPANPNYPIIYDELLSYARRISKTSMPPASTIYAAGPPAIQSELQTPIDGGRQSMTPAAATPSVAQSPAVGNTSALQAQPAAGITRLPDAMAQYLNPLSGQHFFPWPQEDKIRSGALASNQLLIEQGIDPKGFDPVLEQERKKKEEEERKDKEEQEAKERAEKERVLREEREQARLEREKQREKEAAEWRRASEAGGEAPAGGAEKKPEKKQFQFTNLDDLDDDDDDDD
Length324
PositionMiddle
OrganismTorrubiella hemipterigena
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Torrubiella.
Aromaticity0.05
Grand average of hydropathy-0.869
Instability index49.12
Isoelectric point4.95
Molecular weight36175.77
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02134
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.18|      23|      28|     231|     257|       1
---------------------------------------------------------------------------
  231-  257 (32.93/22.79)	VLEQERkkkeEEERKDKEEQEAKERAE
  261-  283 (38.25/18.50)	VLREER....EQARLEREKQREKEAAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     102.91|      28|      29|     118|     146|       2
---------------------------------------------------------------------------
   94-  115 (22.34/ 8.83)	.........TTFPANP...nyPII..YDELLSYARR
  117-  145 (47.35/30.51)	SKTSMPPAsTIYAAGP.....PAI..QSELQTPIDG
  146-  177 (33.22/16.61)	GRQSMTPA....AATPsvaqsPAVgnTSALQAQPAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.85|      29|      29|      27|      55|       3
---------------------------------------------------------------------------
   27-   55 (45.24/28.15)	HPS.MNVADELKAADLELTRGLGKVETHQN
   57-   86 (35.61/20.81)	HLRiLQLREASTALDTQIRETLTSLASTRN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02134 with Med4 domain of Kingdom Fungi
Unable to open file!