<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02132
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYEIFLTAFVEDADYDAACSVVGGLCSMKPWESIYRILYFQGPSRPTGLSNQSSIEKPIRKNVAPLWKELHQNLSRLSFVVQAKYEIVKDRDMGISGKPIEFKTTPGILRWADFPDPPSSKPLLTQRKMVELWEQRDIPSILYDNNYTFKGESIEEVHRFYRDDIEFSFTRQYLFKHVAEYTPLESRQGGDLQPAQSIPAWDSLTPLDMQRRWILKISSHVTQDNKPDEIRAAQDRLMSIRSELEGIFDFKVIDRKVHDTRVSQQQQPIPALLRKV |
| Length | 276 |
| Position | Head |
| Organism | Torrubiella hemipterigena |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Torrubiella.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.522 |
| Instability index | 55.47 |
| Isoelectric point | 6.55 |
| Molecular weight | 32128.27 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02132
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 157.73| 47| 73| 9| 56| 1
---------------------------------------------------------------------------
9- 56 (82.17/54.36) FVEDADY....DAACSVVGGLCSMKPWESIYRILYFQGP..SRPTgLSNQSSIE
79- 131 (75.56/45.31) FVVQAKYeivkDRDMGISGKPIEFKTTPGILRWADFPDPpsSKPL.LTQRKMVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.49| 20| 73| 175| 194| 2
---------------------------------------------------------------------------
175- 194 (36.23/22.60) FKHVAEYTPLE..........SRQGGDLQP
198- 227 (29.26/17.09) IPAWDSLTPLDmqrrwilkisSHVTQDNKP
---------------------------------------------------------------------------
|