<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02117
Description |
Mediator of RNA polymerase II transcription subunit 14 |
Sequence | MASMISLKSLIGKLVHKSYADLLTLTDTLPSMSDVEKKRQILNYTTFVRKQFLKLLVLVKWADCADDIQMCQNIMAFLANQNKMFQDTVDYLHKIHIELPAARVRNFDIPTAVDVLTTGTYQRMPTKLKDMIHPPPFTDEEVLETFQQMNDTIRVRMLTEEVLPSPMQKYRIGNESLFYNNH |
Length | 182 |
Position | Tail |
Organism | Rhizopus microsporus |
Kingdom | Fungi |
Lineage | |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.218 |
Instability index | 44.93 |
Isoelectric point | 6.96 |
Molecular weight | 21157.47 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02117
No repeats found
No repeats found
|