<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02096
| Description |
Uncharacterized protein |
| Sequence | MAANFWTSSHYKQLLDQEEVDVVQSLDKDRGITLEDFKLIKMHMANYILKLAQNVKVRQRVVATAITYMRRVYTRKSMTEYDPRLVTPTCLYLASKAEESTVQARLLVFYIKKIQSDEKYKYEIKHILEMEMKILEALDYYLVVFHPYRALSQLLQDAGLNDINMTQLTWGLVNDTYKMDLILIHPPYLIALACIYIASVLREKDTTAWFEELHVDMNVVSLLKAKLCERGESIQFLLLGSCIEFVGCCNF |
| Length | 251 |
| Position | Kinase |
| Organism | Cucumis sativus (Cucumber) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | 0.026 |
| Instability index | 38.22 |
| Isoelectric point | 6.32 |
| Molecular weight | 29259.95 |
| Publications | PubMed=19881527
PubMed=19495411
PubMed=20565788
PubMed=22047402
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP02096
No repeats found
No repeats found
|