<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02072
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASNHGLKEEEADNPSSPTNVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYLEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNSNFRNAMAHPGNKELAHRQQFYFWKNYRNNRLKHILPRPLPEPAALPPPVTAPPQAAVPAPTSAPNMAASPAAPALSPIQYGIPPGPGLPKNDMKGAGIDRRKRKHERSMT |
| Length | 206 |
| Position | Middle |
| Organism | Cucumis sativus (Cucumber) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.673 |
| Instability index | 58.73 |
| Isoelectric point | 9.15 |
| Molecular weight | 23598.70 |
| Publications | PubMed=19881527
PubMed=19495411
PubMed=20565788
PubMed=22047402
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP02072
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.85| 23| 27| 132| 154| 1
---------------------------------------------------------------------------
132- 154 (45.30/22.60) PRPLPEPAALP.PPVTAPPQAAVP
156- 179 (39.54/18.84) PTSAPNMAASPaAPALSPIQYGIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.57| 20| 27| 32| 51| 2
---------------------------------------------------------------------------
32- 51 (36.56/21.14) FLLELEFVQCLANPTYIHYL
62- 81 (39.01/22.95) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
|