<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02045
Description |
Uncharacterized protein |
Sequence | MESEDKKFGRGPRELTGAVDLISHYKLLPHHDFFCKKSLPLSISDTHYLHNVVGDTEIRKGEGMQLNQLIQNTSYPRETNARIQPFDQDILIEAFQLRETGPVDLPSAEKGVPTIPGKSKSESKDKDRKHKKHKDRDKEKDREHKKHKHRHKDRSKDKDKDKKKEKSGHQDSGADHSKKHHEKKRKHDGEDDINDIHRHKKSKHKASKIEEMGVIKSSF |
Length | 219 |
Position | Head |
Organism | Cucumis sativus (Cucumber) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Cucurbitales> Cucurbitaceae> Benincaseae> Cucumis.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.532 |
Instability index | 38.96 |
Isoelectric point | 9.51 |
Molecular weight | 25459.31 |
Publications | PubMed=19881527
PubMed=19495411
PubMed=20565788
PubMed=22047402
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP02045
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.08| 16| 16| 124| 139| 1
---------------------------------------------------------------------------
124- 139 (29.94/12.01) KDKDRKHKK..HKDRDKE
158- 175 (22.14/ 6.83) KDKDKKKEKsgHQDSGAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.25| 13| 33| 144| 157| 2
---------------------------------------------------------------------------
144- 157 (21.52/11.43) HKKhKHRHKDRSKD
176- 188 (25.73/ 9.80) HSK.KHHEKKRKHD
---------------------------------------------------------------------------
|