<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02042
Description |
Cyclin-dependent kinase 19 (Fragment) |
Sequence | LQLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKQPQQQQQNSTQTNGTAGGAGAGGGGAGAGLQHSQDSSLNQVPPNKKPRIGPSGANSGGPVMPSDYQ |
Length | 370 |
Position | Kinase |
Organism | Charadrius vociferus (Killdeer) (Aegialitis vocifera) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Charadriiformes> Charadriidae> Charadrius.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.541 |
Instability index | 50.37 |
Isoelectric point | 8.55 |
Molecular weight | 42011.57 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02042
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.64| 27| 40| 211| 243| 1
---------------------------------------------------------------------------
211- 243 (37.66/35.28) PTlqkdfRRTTYANSSLIKYMEKHKVkPDSKVF
254- 280 (48.98/28.30) PT.....KRITSEQALQDPYFQEDPL.PTSDVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 37| 85| 99| 2
---------------------------------------------------------------------------
85- 99 (26.77/19.79) DLKPANILVMGEGPE
123- 137 (28.67/21.74) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|