<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02041
| Description |
Transcription elongation factor A protein 2 (Fragment) |
| Sequence | GAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVIALAKSLIKSWKKLLDASEEKSEEKKKSLSLPTSSSKETGNSRDQSFSFSSNKRQEPPKTPTTPKITTFPPAPVTCDAVRNKCREMLTTALQADDDYISIGADCEHIAAQIEEYILTVRDFLKDVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGVITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWK |
| Length | 284 |
| Position | Unknown |
| Organism | Charadrius vociferus (Killdeer) (Aegialitis vocifera) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Charadriiformes> Charadriidae> Charadrius.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.690 |
| Instability index | 52.34 |
| Isoelectric point | 8.93 |
| Molecular weight | 31935.31 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02041
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.13| 12| 19| 162| 174| 1
---------------------------------------------------------------------------
162- 174 (17.94/15.93) LKDVKNTDMKyKN
183- 194 (22.20/13.49) LKDSKNPELK.KN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.82| 14| 15| 58| 71| 2
---------------------------------------------------------------------------
58- 71 (20.96/14.31) SEEKSEEKKKSLSL
76- 89 (23.85/17.32) SKETGNSRDQSFSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.58| 12| 19| 123| 138| 3
---------------------------------------------------------------------------
123- 138 (13.19/22.62) CREMlttALQAdDDYI
144- 155 (22.40/15.48) CEHI...AAQI.EEYI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.26| 25| 25| 227| 251| 4
---------------------------------------------------------------------------
227- 251 (43.89/27.99) KEAIREH.QMAKTGGTQTDLFTCGKC
254- 279 (41.37/26.03) KNCTYTQvQTRSSDEPMTTFVVCNEC
---------------------------------------------------------------------------
|