<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02023
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MSTPPLAGAGMPPGAFSGTQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEDGSKHDDCGTASQLRFASEERREIMEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 179 |
Position | Head |
Organism | Charadrius vociferus (Killdeer) (Aegialitis vocifera) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Charadriiformes> Charadriidae> Charadrius.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.489 |
Instability index | 46.64 |
Isoelectric point | 7.68 |
Molecular weight | 20391.23 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02023
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 71| 76| 96| 1
---------------------------------------------------------------------------
76- 96 (35.37/22.94) KLQEHLRQLSILFRKLR.LVYD
149- 170 (32.88/20.90) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|