<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02012
| Description |
Cyclin-dependent kinase 8 (Fragment) |
| Sequence | KDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNT |
| Length | 244 |
| Position | Kinase |
| Organism | Tinamus guttatus (White-throated tinamou) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.309 |
| Instability index | 41.70 |
| Isoelectric point | 8.85 |
| Molecular weight | 28373.65 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02012
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.09| 21| 26| 26| 50| 1
---------------------------------------------------------------------------
20- 41 (30.36/12.52) ACREIaLLREL.KHP..NVISLQKV
46- 70 (22.73/16.98) ADRKVwLLFDYaEHDlwHIIKFHRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 36| 108| 122| 2
---------------------------------------------------------------------------
108- 122 (26.77/18.56) DLKPANILVMGEGPE
146- 160 (28.67/20.35) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|