Description | Cyclin-dependent kinase 8 (Fragment) |
Sequence | KDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNT |
Length | 244 |
Position | Kinase |
Organism | Tinamus guttatus (White-throated tinamou) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.309 |
Instability index | 41.70 |
Isoelectric point | 8.85 |
Molecular weight | 28373.65 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro protein kinase activity GO:0004672 IEA:InterPro |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP02012 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.09| 21| 26| 26| 50| 1 --------------------------------------------------------------------------- 20- 41 (30.36/12.52) ACREIaLLREL.KHP..NVISLQKV 46- 70 (22.73/16.98) ADRKVwLLFDYaEHDlwHIIKFHRA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.44| 15| 36| 108| 122| 2 --------------------------------------------------------------------------- 108- 122 (26.77/18.56) DLKPANILVMGEGPE 146- 160 (28.67/20.35) DLDPVVVTFWYRAPE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KDYALKQIE 2) LMKDFR | 4 236 | 12 241 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab