<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02010
Description |
Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
Sequence | GAVAAAASPGYRLSTLIDFLLHRTYAELTVLADLLPRKTDMERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKSEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDIPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADEKPLQDMYSCLHSFCLALQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDETDVSKPLQISHEPPLPACDSKLMERAMKIDHLSIEKLLIDSVHARSHQKLQELKAILKSYNVNDNSVIETALPTLVIPILEPCGRSECLHVFVDLHSGMFQLMLHGVDQLTLDDVEKSVNDDMKRIIPWLQQLKFWLGQQRCKQSIKHLPTVSSETLQLANYTSHPVGNLSKHKLFIKLTRLPQYYIVVEMFDVPGNPTELEYKYHFLSVSYAEGDDSPATALLLQQFKANIEELVLDAKNGKQIKSGAKRKLSGDPCSTEPKKPKRSGEMCAFNKVLAHIVAMCDTNMPFIGLRMELSNMDIPHQGVQVEGDGFSHAIRLLKIPPCKGVNEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLTSASSREQGPTRHVYLTYENQLSEPVGGRKVVEMFLNDWSSIARLYECVLEFARSLP |
Length | 750 |
Position | Tail |
Organism | Tinamus guttatus (White-throated tinamou) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.166 |
Instability index | 39.07 |
Isoelectric point | 7.89 |
Molecular weight | 84648.10 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02010
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 247.28| 78| 149| 257| 341| 1
---------------------------------------------------------------------------
257- 341 (124.13/113.82) CLHSFCLALQLEvLHSQTLMLIRERWGDLV..QVERYHAGKCLSLSVWNQQV...LGRKTGTASV.HKVTIKiDETdvskpLQISHEPPLP
408- 491 (123.15/91.95) CGRSECLHVFVD.LHSGMFQLMLHGVDQLTldDVEKSVNDDMKRIIPWLQQLkfwLGQQRCKQSIkHLPTVS.SET.....LQLANYTSHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.48| 11| 32| 169| 179| 3
---------------------------------------------------------------------------
169- 179 (19.28/11.75) DLPPQLANLTV
204- 214 (20.20/12.68) DIPWRLLKLEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.75| 19| 30| 89| 107| 4
---------------------------------------------------------------------------
89- 107 (29.16/16.64) ILFVDTADRLASLARDALV
122- 140 (33.58/20.16) VLTTGSYPRLPTCIRDKII
---------------------------------------------------------------------------
|