<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02009
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MSTPPLAGAGMPPGAFSGTQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTGTYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEDGSKHDDRGAASQLRFATEERREILEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 179 |
Position | Head |
Organism | Tinamus guttatus (White-throated tinamou) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.503 |
Instability index | 46.82 |
Isoelectric point | 8.46 |
Molecular weight | 20410.24 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02009
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.25| 21| 71| 76| 96| 1
---------------------------------------------------------------------------
76- 96 (35.37/21.34) KLQEHLRQLSILFRKLR.LVYD
149- 170 (32.88/19.44) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|