<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02004

Description Cyclin-dependent kinase 19 (Fragment)
SequenceLQLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKLGLNQHLTQSRSRSLPRHQDSSLNQVPPTKKPRMGPSGANSGGPVMPSDYQHSSSRLSYQSNIQGSSQSQSTMGYSTSSQQSSQY
Length389
PositionKinase
OrganismTinamus guttatus (White-throated tinamou)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
Aromaticity0.09
Grand average of hydropathy-0.587
Instability index58.92
Isoelectric point9.07
Molecular weight44781.67
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02004
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.64|      27|      40|     211|     243|       1
---------------------------------------------------------------------------
  211-  243 (37.66/38.85)	PTlqkdfRRTTYANSSLIKYMEKHKVkPDSKVF
  254-  280 (48.98/31.12)	PT.....KRITSEQALQDPYFQEDPL.PTSDVF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      35|      85|      99|       2
---------------------------------------------------------------------------
   85-   99 (26.77/17.79)	DLKPANILVMGEGPE
  123-  137 (28.67/19.53)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     113.20|      32|      42|     284|     325|       3
---------------------------------------------------------------------------
  284-  315 (55.03/46.23)	QIPYPKREFLNEDEPEEKGDKLGLNQHLTQSR
  329-  360 (58.18/28.93)	QVPPTKKPRMGPSGANSGGPVMPSDYQHSSSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.31|      12|      14|     361|     372|       4
---------------------------------------------------------------------------
  361-  372 (21.34/13.14)	LSYQSNIQGSSQ
  377-  388 (21.97/13.71)	MGYSTSSQQSSQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02004 with CDK8 domain of Kingdom Metazoa
Unable to open file!