<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01997
| Description |
Transcription elongation factor A protein 3 (Fragment) |
| Sequence | GALDLLKSLTGYTMTIQLLQTTRIGVAVNSVRKHCSDEEVVASAKILIKNWKRLLDVRGSAAVSSSSSPQKRPSGERANSSKGRAEPLRSSASPSSPSACLLSRCYLTGDSVRDKCIEMLTAALRMDDDYKEFGVNCEKMASEIEEHILWDTRGAPGGVQGPHIFQELKSTDMKYRNRVRSRISNLKDPKNPNLRRNVLCGAIAPGLIARMTAEEMASDELKELRNAMTQEAIREHQMAKTGGTVTDLFQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWK |
| Length | 287 |
| Position | Unknown |
| Organism | Tinamus guttatus (White-throated tinamou) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.539 |
| Instability index | 55.16 |
| Isoelectric point | 9.18 |
| Molecular weight | 31778.04 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01997
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.82| 16| 22| 58| 74| 1
---------------------------------------------------------------------------
58- 74 (24.49/16.15) RGSA.AVSSSSSPQKrPS
82- 98 (25.32/12.29) KGRAePLRSSASPSS.PS
---------------------------------------------------------------------------
|