<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01988
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MAEGVLSAGVNLEAFSQAIAAIQALRSSVTRVFDCLKDGMRNKETLEGREKGFVAAFQESLHSVSRDLGELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQ |
| Length | 161 |
| Position | Tail |
| Organism | Tinamus guttatus (White-throated tinamou) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.384 |
| Instability index | 51.59 |
| Isoelectric point | 9.52 |
| Molecular weight | 17592.85 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01988
No repeats found
|