<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01988
Description |
Mediator of RNA polymerase II transcription subunit 27 |
Sequence | MAEGVLSAGVNLEAFSQAIAAIQALRSSVTRVFDCLKDGMRNKETLEGREKGFVAAFQESLHSVSRDLGELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQ |
Length | 161 |
Position | Tail |
Organism | Tinamus guttatus (White-throated tinamou) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Tinamiformes> Tinamidae> Tinamus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.384 |
Instability index | 51.59 |
Isoelectric point | 9.52 |
Molecular weight | 17592.85 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01988
No repeats found
|