<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01953

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMTLPPSEPASSPRPCVSALSACAGGRAVRKMAASSSGEKEKERLGGGLGMASGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
Length300
PositionMiddle
OrganismPapio anubis (Olive baboon)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Papio.
Aromaticity0.03
Grand average of hydropathy-0.576
Instability index55.14
Isoelectric point5.25
Molecular weight32786.65
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:Ensembl
nucleoplasm	GO:0005654	IEA:Ensembl
GO - Biological Function
thyroid hormone receptor binding	GO:0046966	IEA:Ensembl
transcription coactivator activity	GO:0003713	IEA:Ensembl
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
transcription by RNA polymerase II	GO:0006366	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP01953
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     104.57|      27|      28|      85|     111|       1
---------------------------------------------------------------------------
   59-   79 (30.78/14.95)	RLLSALE...D...LEVL..SR..ELIEMLA
   85-  111 (47.46/25.97)	KLLQAGE...ENQVLELLI.HRDGEFQELMK
  114-  142 (26.32/12.01)	..LNQGKihhEMQVLEKEVeKRDSDIQQLQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.07|      23|      23|     246|     268|       2
---------------------------------------------------------------------------
  246-  268 (44.66/26.85)	LAPQYPWQSNDMSMNMLPPNHSS
  272-  294 (39.42/22.94)	LEPPGHNKENEDDVEIMSTDSSS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01953 with Med4 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) TWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG
2) WQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
196
252
240
300

Molecular Recognition Features

MoRF SequenceStartStop
1) GRAVRKMA
25
32