<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01950
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Papio anubis (Olive baboon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Papio.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.030 |
| Instability index | 61.96 |
| Isoelectric point | 9.86 |
| Molecular weight | 28109.76 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.11| 16| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (36.40/11.13) PPPPPTALGFGPGKPP
48- 63 (37.71/11.78) PPPPPPGGGPGTAPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.72| 28| 115| 116| 147| 2
---------------------------------------------------------------------------
116- 147 (46.33/24.89) KKVKEKLSN.FLPDLPGMidlpGSHDNSSLRSL
232- 260 (47.40/19.00) KKEKKKKKNrHSPDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.86| 16| 18| 187| 202| 3
---------------------------------------------------------------------------
187- 202 (28.50/12.57) PPK...KKNKHKHKQSRTQ
206- 224 (21.35/ 7.85) PPEtpsDSDHKKKKKKKEE
---------------------------------------------------------------------------
|