Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MANERLRILEDVEKDIAVVLQCAGNIVLELSKDKHNASFLDRQLVQFQTSISRVENELGAQIRYLTQVATGQPHEGSTYSTRKDCQMSLNRAEYAKVKLGELGRTCEAMLYDRT |
Length | 114 |
Position | Head |
Organism | Poecilia formosa (Amazon molly) (Limia formosa) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Neoteleostei> Acanthomorphata> Ovalentaria> Atherinomorphae> Cyprinodontiformes> Poeciliidae> Poeciliinae> Poecilia. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.447 |
Instability index | 26.51 |
Isoelectric point | 6.11 |
Molecular weight | 12920.54 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01931 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KVKLGELGR 2) LDRQLV 3) QTSISRV 4) SLNRAE 5) VATGQPHEGSTYSTR | 96 40 48 88 68 | 104 45 54 93 82 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab