<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01925
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEALPTILPPPPLPDGSEKPTRSPEKHANLVRFQSELEFIQCLAHPQYLHELHIQGYLGKPAFLNYLKYLEYWREPHYVRFIIYPTCLVYLTLLQTELFRSRLGDMGFITELMRVGSRHHATWRVEKPAGVTQPEEKLAVPMVTLDDDEEEDEPEREGETKGKRRKKKSRSGNMGVSQAS |
| Length | 180 |
| Position | Middle |
| Organism | Cryptococcus gattii serotype B (strain R265) (Filobasidiella gattii) (Cryptococcus bacillisporus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus gattii species complex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.644 |
| Instability index | 59.30 |
| Isoelectric point | 6.39 |
| Molecular weight | 20845.63 |
| Publications | PubMed=21304167
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01925
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 130.82| 38| 47| 27| 73| 1
---------------------------------------------------------------------------
27- 67 (63.59/54.55) HANLVRFqseLEFIQCLAHPQYLHELHIQGYLGKPAFLNYL
75- 112 (67.23/36.12) EPHYVRF...IIYPTCLVYLTLLQTELFRSRLGDMGFITEL
---------------------------------------------------------------------------
|