<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01922

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMNGSSEQRSSSNIAFEDLRLSIDPTTISLALGEKHVKSIEGDGTLVYDEHKMPDAKLTEQLERIWNEYPSGLLEITEQKLERLPPDENANKPQEEGVDEAKKHDPFSMMTYEEMEKLRSEVFLQLNDARNELWFVLELAKTLSLSSSFTTQPPPPPTALHQKKGKAKPAPPALTTLPSIPGEPPILPPGTFSTTLSEFPTKPLHAQIYELEQLLQAKQIALNECQGLIDGAVGELRLMAHAGDRFWKDIRNLKEGEGGRGKWAVVPKPDFGRVGGKGEKAKDVIIPYAIDEAPSGTRARCLAGFDLDPTKKNGLTFGDRHHLRLRATLRDDSGSIISSTPAEVEDQSDVRAMMDAVQMEAFDEDLFNEIRFVAARIPKSDIEPQCVSFPVADKVLSFELYNTRSPSSSPTSPICDVIISSIRLSLLNIQRQRKINLVSPSQNLTSPVPSILQPIIDTLRFRQLCSVVSSTLNEFDRTLRNARLDSRIEKELLKDGQDEVKEMREVLLGKRGAEVLTGKYSLGIDDSYAIIVGVFAPYSTIVHLSSISFPLANPHELSQVVSDDLSVQLLRLAARHLHGKLADEHKEGLYCDTLEEVIRIGEIALLRLSIPAPFHAICGSVESERISVPAYDSRQSGVGVFAWLDTVTQSIENSLSSNGSATQIS
Length664
PositionHead
OrganismCryptococcus gattii serotype B (strain R265) (Filobasidiella gattii) (Cryptococcus bacillisporus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes> Tremellales> Cryptococcaceae> Cryptococcus> Cryptococcus gattii species complex.
Aromaticity0.06
Grand average of hydropathy-0.322
Instability index51.05
Isoelectric point5.23
Molecular weight73384.45
Publications
PubMed=21304167

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP01922
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     127.72|      38|     104|     520|     559|       1
---------------------------------------------------------------------------
  520-  559 (61.87/42.02)	SLGIDDSYAIIVGVFAPYSTIVHlsSISFPLANPHELSQV
  626-  663 (65.85/39.24)	SVPAYDSRQSGVGVFAWLDTVTQ..SIENSLSSNGSATQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.57|      14|      17|     170|     183|       2
---------------------------------------------------------------------------
  153-  166 (26.03/13.52)	PPPP..TALHQKKGKA
  170-  183 (27.06/14.34)	PPAL..TTLPSIPGEP
  187-  202 (22.47/10.68)	PPGTfsTTLSEFPTKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      64.08|      17|      17|     443|     459|       3
---------------------------------------------------------------------------
  410-  422 (17.48/ 7.20)	.....................TSPICDV...IISSIR
  423-  459 (18.80/ 8.24)	LsllniqrqrkinlvspsqnlTSPVPSILQPIIDTLR
  463-  479 (27.80/15.29)	L....................CSVVSSTLNEFDRTLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.04|      15|      15|     246|     260|       5
---------------------------------------------------------------------------
  246-  260 (28.52/16.79)	WKDIRNLKEGE.GGRG
  262-  277 (25.52/14.31)	WAVVPKPDFGRvGGKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.82|      28|     531|      29|      64|       6
---------------------------------------------------------------------------
   29-   64 (31.46/44.10)	LALGEKHVKsiegdGTLVyDEHKmpDAKLTEQLERI
  569-  596 (49.36/32.84)	LRLAARHLH.....GKLA.DEHK..EGLYCDTLEEV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP01922 with Med17 domain of Kingdom Fungi

Unable to open file!