<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01922
Description |
Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MNGSSEQRSSSNIAFEDLRLSIDPTTISLALGEKHVKSIEGDGTLVYDEHKMPDAKLTEQLERIWNEYPSGLLEITEQKLERLPPDENANKPQEEGVDEAKKHDPFSMMTYEEMEKLRSEVFLQLNDARNELWFVLELAKTLSLSSSFTTQPPPPPTALHQKKGKAKPAPPALTTLPSIPGEPPILPPGTFSTTLSEFPTKPLHAQIYELEQLLQAKQIALNECQGLIDGAVGELRLMAHAGDRFWKDIRNLKEGEGGRGKWAVVPKPDFGRVGGKGEKAKDVIIPYAIDEAPSGTRARCLAGFDLDPTKKNGLTFGDRHHLRLRATLRDDSGSIISSTPAEVEDQSDVRAMMDAVQMEAFDEDLFNEIRFVAARIPKSDIEPQCVSFPVADKVLSFELYNTRSPSSSPTSPICDVIISSIRLSLLNIQRQRKINLVSPSQNLTSPVPSILQPIIDTLRFRQLCSVVSSTLNEFDRTLRNARLDSRIEKELLKDGQDEVKEMREVLLGKRGAEVLTGKYSLGIDDSYAIIVGVFAPYSTIVHLSSISFPLANPHELSQVVSDDLSVQLLRLAARHLHGKLADEHKEGLYCDTLEEVIRIGEIALLRLSIPAPFHAICGSVESERISVPAYDSRQSGVGVFAWLDTVTQSIENSLSSNGSATQIS |
Length | 664 |
Position | Head |
Organism | Cryptococcus gattii serotype B (strain R265) (Filobasidiella gattii) (Cryptococcus bacillisporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus gattii species complex.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.322 |
Instability index | 51.05 |
Isoelectric point | 5.23 |
Molecular weight | 73384.45 |
Publications | PubMed=21304167
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01922
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 127.72| 38| 104| 520| 559| 1
---------------------------------------------------------------------------
520- 559 (61.87/42.02) SLGIDDSYAIIVGVFAPYSTIVHlsSISFPLANPHELSQV
626- 663 (65.85/39.24) SVPAYDSRQSGVGVFAWLDTVTQ..SIENSLSSNGSATQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.57| 14| 17| 170| 183| 2
---------------------------------------------------------------------------
153- 166 (26.03/13.52) PPPP..TALHQKKGKA
170- 183 (27.06/14.34) PPAL..TTLPSIPGEP
187- 202 (22.47/10.68) PPGTfsTTLSEFPTKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 64.08| 17| 17| 443| 459| 3
---------------------------------------------------------------------------
410- 422 (17.48/ 7.20) .....................TSPICDV...IISSIR
423- 459 (18.80/ 8.24) LsllniqrqrkinlvspsqnlTSPVPSILQPIIDTLR
463- 479 (27.80/15.29) L....................CSVVSSTLNEFDRTLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.04| 15| 15| 246| 260| 5
---------------------------------------------------------------------------
246- 260 (28.52/16.79) WKDIRNLKEGE.GGRG
262- 277 (25.52/14.31) WAVVPKPDFGRvGGKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.82| 28| 531| 29| 64| 6
---------------------------------------------------------------------------
29- 64 (31.46/44.10) LALGEKHVKsiegdGTLVyDEHKmpDAKLTEQLERI
569- 596 (49.36/32.84) LRLAARHLH.....GKLA.DEHK..EGLYCDTLEEV
---------------------------------------------------------------------------
|