<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01920
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAQTTPRSHPPPYSLLQNLTTQSLLLSHLFTLIASPPNPNTSTQTQLTQVYSALQLSTLDLSGIVREVGQHQEAYRRLVEKKKEVAGLEMRVRGLVKRLEEGRKELEGMIDQGEKSLEDIEKSEREPVPAKTLMAHAQSLSKHSSAPVSSLLAPVDKAQYAPWPTEMSMRMGLLFQLEGSMSGMGERGVVGEEQKAPKKVEGRREHVEHEESGRRYDPNAVFQLDLNSDDSDED |
Length | 234 |
Position | Middle |
Organism | Cryptococcus gattii serotype B (strain R265) (Filobasidiella gattii) (Cryptococcus bacillisporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus gattii species complex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.680 |
Instability index | 50.17 |
Isoelectric point | 5.59 |
Molecular weight | 26114.17 |
Publications | PubMed=21304167
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01920
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.25| 14| 16| 122| 135| 1
---------------------------------------------------------------------------
122- 135 (23.40/16.09) KSEREPVPAKTLMA
140- 153 (21.85/14.55) LSKHSSAPVSSLLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.67| 16| 16| 66| 81| 2
---------------------------------------------------------------------------
66- 81 (27.10/19.76) REVGQHQEAYRRLVEK
83- 98 (25.56/18.26) KEVAGLEMRVRGLVKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.75| 11| 36| 13| 24| 3
---------------------------------------------------------------------------
13- 24 (15.29/13.72) YSLLQnLTTQSL
51- 61 (19.47/11.78) YSALQ.LSTLDL
---------------------------------------------------------------------------
|