Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAQTTPRSHPPPYSLLQNLTTQSLLLSHLFTLIASPPNPNTSTQTQLTQVYSALQLSTLDLSGIVREVGQHQEAYRRLVEKKKEVAGLEMRVRGLVKRLEEGRKELEGMIDQGEKSLEDIEKSEREPVPAKTLMAHAQSLSKHSSAPVSSLLAPVDKAQYAPWPTEMSMRMGLLFQLEGSMSGMGERGVVGEEQKAPKKVEGRREHVEHEESGRRYDPNAVFQLDLNSDDSDED |
Length | 234 |
Position | Middle |
Organism | Cryptococcus gattii serotype B (strain R265) (Filobasidiella gattii) (Cryptococcus bacillisporus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes> Tremellales> Cryptococcaceae> Cryptococcus> Cryptococcus gattii species complex. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.680 |
Instability index | 50.17 |
Isoelectric point | 5.59 |
Molecular weight | 26114.17 |
Publications | PubMed=21304167 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01920 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.25| 14| 16| 122| 135| 1 --------------------------------------------------------------------------- 122- 135 (23.40/16.09) KSEREPVPAKTLMA 140- 153 (21.85/14.55) LSKHSSAPVSSLLA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.67| 16| 16| 66| 81| 2 --------------------------------------------------------------------------- 66- 81 (27.10/19.76) REVGQHQEAYRRLVEK 83- 98 (25.56/18.26) KEVAGLEMRVRGLVKR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.75| 11| 36| 13| 24| 3 --------------------------------------------------------------------------- 13- 24 (15.29/13.72) YSLLQnLTTQSL 51- 61 (19.47/11.78) YSALQ.LSTLDL --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) RKELEGMIDQGEKSLEDIEKSEREPVPAKTLMAHAQSLSKHSSAPVS 2) SGMGERGVVGEEQKAPKKVEGRREHVEHEESGRRYDPNAVFQLDLNSDDSDED | 103 182 | 149 234 |
MoRF Sequence | Start | Stop |
1) DPNAVFQLDLN | 217 | 227 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab