Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MTSLNSDEMRAIDQTRTRLDQLTKSIGALKNDILRSPVMPPIDSIQVHSTILAQSLKNITDHLSKHSDLFSQTVVYPSTNFPGRTQEGLIGQLLRKKLEPSAESWVEEGRALGKTENGGAGQDENLDELWSFAKDYVLPQVAKAAQLSRSSLDDIYAESDEEDEEEEEEGEEGGEGKAHAFGDGGSRNPSGVSRDLNAITRFMTTGTATGN |
Length | 211 |
Position | Head |
Organism | Pseudogymnoascus sp. VKM F-4516 (FW-969) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.699 |
Instability index | 52.52 |
Isoelectric point | 4.61 |
Molecular weight | 23009.96 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01912 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 102.37| 31| 52| 92| 122| 1 --------------------------------------------------------------------------- 92- 122 (53.93/30.30) QLLRKKLEP.SAESWVEEGRALGKTENGGAGQ 146- 177 (48.44/26.57) QLSRSSLDDiYAESDEEDEEEEEEGEEGGEGK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DIYAE 2) EEEEEE 3) EGKAHAFGD 4) SGVSRDLNAITRFMTTGTATGN | 154 164 175 190 | 158 169 183 211 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab