<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01910

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMKLPAQASADALVTTNADVFEAAKIESQVQPRSGEERGGDLRDGAGRAEGQVEGNMPGVIMENGYGTGAHTNHDRDGAPNGTNGAVQASSRPTEKSGQAGQQPSPNQSVQMNGANGAPMTQSTDHPAGSVSNDGSNLAKNAPPEIGHITEGFESLPNLLTRLAQVTHNQLSGKLLELAGMNIQQSPDNSNAVSFVSGPDDNSAENIKKKVNLLKFAEGIHSNWTKALVITQWSRISEEVSRVIDLKAHLDEQKLYYDIAVHELSEVKRSLVHARLPNPDLRTAVEVLSTGKASWMPDLGYIEPPPLTAKEILQSLQNLNTLLSIRLNLHDYDKIPYHFRNYTIKSGRVTFRVEGEFEVDLTIADEDPEKQFWFIDFRFLFSPSPSALTDQMRFSLESKVNAVLEKDGLEGCYKVLHDLTLTHKISELRRQAYEIGRSRWIDSLMVEPLRRSLSIQYWVDRYGRDGPRSWIIIGVVSGKKKGTYHDEKETSRIGIRWFRDSKEVKDIEIPLELTTLSVEGLLRSVITMHVSHILESMYKNLRTKPLYENRDLALSFKKPTAAEKEPELHVQLTSQYQINVIVEYITGKFAISPSSRLTSQAEFRLNNGTIDPASNGHEYIENLHCVLISEDTVNRAYTVGWAPVRNPRLPQDQLKPFLPRDTLQLSWFKKPGWDPNWYLALSSGMSGERWWLIEITNVAEGPRPTADSIVLDGPTVRSHIQLPLKSVSPAPTYAFLSSLHLLSTSMISYYTNMRALHSRRAKFMLRNTSKRTVSSRQGQPALYVMLSTLLPSKNKSPRTGKPWAKDVLKISFQGIEALEPKETTSPAVGSDQSPSNPPTAPSGPVSSQDGEEGAIMIAEGHMETAIPAGLLVKQQVDKDIAFHPSTSAFAFRLQARVGEPSIAPLIERLQRVERLVDFVQVITAHPDSLHCESVSLSRLIFSYGCVQSAGPNQSHAESPRYQAIIDFSSQSSQLELQLEAGNPHIRILDHLTKILNSPLGLHGLATILPLTLPVLRALDAAEDSWEDIPSSELQILCRAADWYAVRYILTPPGDGDNSKTPPAPKRVVFEIRLHRRGNVPWWCMRRDQKHNPATVDPLDLALREKVWTGGEKGVWMGMQCAAIAQTGGAEAMVSRVDTAMRDMMGDGTVFASAAPGAAGVKAAEGAGENIHALGQAQAQAVNAPNKAQPQRPQTKSPVLQKQTQKAQGVQPTQQQRALAEAQHRVQFQAQQLARQKEMHRQAQAQARQGQGQQRPNANPNGGNGNSGNQDAIVID
Length1274
PositionTail
OrganismPseudogymnoascus sp. VKM F-4516 (FW-969)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus.
Aromaticity0.06
Grand average of hydropathy-0.460
Instability index47.55
Isoelectric point6.96
Molecular weight140578.19
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01910
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     136.08|      31|      32|      62|      92|       1
---------------------------------------------------------------------------
   34-   64 (26.32/ 9.80)	...GEERGGDlRDGA.GRAEGQ..VE.GNMP........gvimENG
   65-   96 (49.37/24.93)	YGTGAHTNHD.RDGAPNGTNGA..VQASSRP...........tEKS
   97-  141 (38.52/17.81)	GQAGQQPSPN.QSVQMNGANGApmTQSTDHPagsvsndgsnlaKNA
 1248- 1263 (21.87/ 6.87)	GQGQQRPNAN.....PNGGNG.........................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.90|      13|      28|     920|     932|       3
---------------------------------------------------------------------------
  920-  932 (25.14/16.30)	VITAHPDSLHCES
  945-  957 (23.76/14.94)	VQSAGPNQSHAES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     114.68|      28|      28|    1127|    1154|       4
---------------------------------------------------------------------------
 1043- 1062 (16.35/ 6.47)	.........AVRYI..LtppGDGD.......NSKTP..PA
 1091- 1128 (27.67/17.21)	PATVDPLDLALREK..VwtgGEKGVWmgmqcAAIAQtgGA
 1129- 1156 (48.02/36.52)	EAMVSRVDTAMRDM..M...GDGTVF.....ASAAP..GA
 1157- 1183 (22.64/12.45)	.AGVKAAEGAGENIhaL...GQAQAQ.....AVNAP....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      28.89|       9|      28|     278|     287|       5
---------------------------------------------------------------------------
  278-  287 (11.83/12.40)	PDLrTAVEVL
  304-  312 (17.06/11.19)	PPL.TAKEIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.79|      17|      29|     626|     642|       6
---------------------------------------------------------------------------
  626-  642 (30.80/15.21)	LISEDTVNRAY..TVGWAP
  656-  674 (29.99/14.64)	FLPRDTLQLSWfkKPGWDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.06|      15|      15|     725|     739|       8
---------------------------------------------------------------------------
  725-  739 (26.62/16.61)	SVSPAPTYAFLSSLH
  742-  756 (27.45/17.35)	STSMISYYTNMRALH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.12|      17|      32|     982|     998|       9
---------------------------------------------------------------------------
  982-  998 (30.83/18.01)	PHIRIL....DHLTKILNSPL
 1012- 1032 (25.30/13.53)	PVLRALdaaeDSWEDIPSSEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.10|      24|      37|    1185|    1209|      10
---------------------------------------------------------------------------
 1185- 1209 (37.21/30.03)	KAQPQRPQ.TKSPVLQKQTQkAQGVQ
 1223- 1247 (36.89/24.39)	RVQFQAQQlARQKEMHRQAQ.AQARQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01910 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DMMGDGTVFASAAPGAAGVKAAEGAGENIHALGQAQAQAVNAPNKAQPQRPQTKSPVLQKQTQKAQGVQPTQQQRALAEAQHRVQFQAQQLARQKEMHRQAQAQARQGQGQQRPNANPNGGNGNSGNQDAIVID
2) MKLPAQASADALVTTNADVFEAAKIESQVQPRSGEERGGDLRDGAGRAEGQVEGNMPGVIMENGYGTGAHTNHDRDGAPNGTNGAVQASSRPTEKSGQAGQQPSPNQSVQMNGANGAPMTQSTDHPAGSVSNDGSNLAKNAPPEIGHITEGFE
3) PKETTSPAVGSDQSPSNPPTAPSGPVSSQDGEEGAIMIA
1141
1
819
1274
153
857










Molecular Recognition Features






MoRF SequenceStartStop




NANANA