Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLTAAVPGEHVKEALKILQGLCAMPPAHSYQRVLTYEGPSAQLVPIPAARVQNRRPQDREVWNELNKQLVRQSHYITLAFAAEKGEFGVGAEERVGEKPVMDLEEARGTLHFYDYPEPPHPSRPVNSRLVIHIPDEPKLPSLLRSIKYTHYSQSLREIYNFYRDNVTFTLSRELQRKQQNGVIDVEESTPQASSDIRDYIPFDGENKWVLRASVEVTDEKEGPLVQRGIEELLKVQSDLAGLYEFSILDRAVLDTRVPAFLEQLRRR |
Length | 271 |
Position | Head |
Organism | Pseudogymnoascus sp. VKM F-103 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.528 |
Instability index | 64.71 |
Isoelectric point | 5.82 |
Molecular weight | 31110.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01903 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 288.54| 81| 81| 84| 164| 1 --------------------------------------------------------------------------- 40- 110 (91.78/55.98) ........YEGPSAQLVPIpAARVQNRRPQDREVWNELNKqlVRQSHY.IT.L....AFAAEKGEFGVGAE.ERVGEKPVMDLEEA 111- 192 (135.22/85.85) RGTLHFYDYPEPPHPSRPV.NSRLVIHIPDEPKLPSLLRS..IKYTHYSQS.LREIYNFYRDNVTFTLSRElQRKQQNGVIDVEES 195- 248 (61.53/35.19) QASSDIRDYIPFDGENKWV..LRASVEVTDEKEGPLVQRG..IEELLKVQSdLAGLYE............................ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RLVIHI 2) TLHFYDY | 132 113 | 137 119 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab