Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADQQQGNVQASAFPSPPPFYQHFTEENLARVAILRAGRESDSSQKDDSPKEPELRGDLQYLQPPEPPAEGTYRSFGDLYNLNDILPSLTEQGIEQLYSPPATPSGSGAGSDPQSHSDRTLILKRIAKSLLLNFLELMGIMSVNPEQYAEKIQDLRTLFINFHHLLNEYRPHQARESLILMMEAQLARSKAETNGIENMKTKVEGILAGLGQVNIAPEEAEEYKDIKKDLEEYDGAKDVWDELHREYGLVEPGKSS |
Length | 256 |
Position | Middle |
Organism | Pseudogymnoascus sp. VKM F-103 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.683 |
Instability index | 63.93 |
Isoelectric point | 4.76 |
Molecular weight | 28696.69 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01902 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 65.43| 18| 34| 50| 68| 1 --------------------------------------------------------------------------- 50- 68 (31.75/22.45) PKEPElRGDLQYLQPPEPP 87- 104 (33.69/19.35) PSLTE.QGIEQLYSPPATP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.08| 21| 25| 128| 150| 2 --------------------------------------------------------------------------- 128- 150 (30.99/24.75) KSLLLNFLELMGimSVNPEQYAE 156- 176 (39.09/24.28) RTLFINFHHLLN..EYRPHQARE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LRGDLQYLQ 2) PFYQHFTEENL 3) YKDIKK | 55 19 223 | 63 29 228 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab