<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01902
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADQQQGNVQASAFPSPPPFYQHFTEENLARVAILRAGRESDSSQKDDSPKEPELRGDLQYLQPPEPPAEGTYRSFGDLYNLNDILPSLTEQGIEQLYSPPATPSGSGAGSDPQSHSDRTLILKRIAKSLLLNFLELMGIMSVNPEQYAEKIQDLRTLFINFHHLLNEYRPHQARESLILMMEAQLARSKAETNGIENMKTKVEGILAGLGQVNIAPEEAEEYKDIKKDLEEYDGAKDVWDELHREYGLVEPGKSS |
| Length | 256 |
| Position | Middle |
| Organism | Pseudogymnoascus sp. VKM F-103 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.683 |
| Instability index | 63.93 |
| Isoelectric point | 4.76 |
| Molecular weight | 28696.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01902
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.43| 18| 34| 50| 68| 1
---------------------------------------------------------------------------
50- 68 (31.75/22.45) PKEPElRGDLQYLQPPEPP
87- 104 (33.69/19.35) PSLTE.QGIEQLYSPPATP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.08| 21| 25| 128| 150| 2
---------------------------------------------------------------------------
128- 150 (30.99/24.75) KSLLLNFLELMGimSVNPEQYAE
156- 176 (39.09/24.28) RTLFINFHHLLN..EYRPHQARE
---------------------------------------------------------------------------
|