<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01888
| Description |
Uncharacterized protein |
| Sequence | MEMKRSISDSRRSRSRSPSADQTANEASQAAIKHVGVVTHVAPLVPPTPLRSAEHSRTGPSTNELMEREQGIIDAMLLRFKNIIELATTNKGDVTSEVAAAQAFQTNVETQALIRAAQDLLSLTREMKELWLFGPLRGLGEGEEGGTIDDDSKKVVEMVETMINERTRRET |
| Length | 171 |
| Position | Head |
| Organism | Pseudogymnoascus sp. VKM F-4516 (FW-969) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.516 |
| Instability index | 54.76 |
| Isoelectric point | 5.50 |
| Molecular weight | 18858.07 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01888
No repeats found
|