<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01882
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELFLTAAVPGEHVKEALKILQGLCAMPPVHKFERILTYEGPNAQLVPIPAARVQNRRPQDREVWNELNKQLVRQSHFITLAFAAEKGEFGAGAGVGAGEDQAEKPVIDLEEARGTLHFYDYPEPPHPSRPVNSRLVVHIPDEPKLPSLLRSIKYTHHSESLREIYNSYRDNVTFTLSRELQRKAQDGVTGAQGGVLQASSDLRDYVPFDGENKWVLRASVEVTDEKEGPLLQRGIEELLRVQTDLEGVYEFSVLDRSVLDTRVPAFLEQLRRR |
| Length | 275 |
| Position | Head |
| Organism | Pseudogymnoascus sp. VKM F-4516 (FW-969) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.491 |
| Instability index | 59.58 |
| Isoelectric point | 5.77 |
| Molecular weight | 31103.79 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01882
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.17| 15| 19| 183| 201| 1
---------------------------------------------------------------------------
187- 201 (27.00/21.30) QDGV..TGAQGGVLQAS
205- 221 (22.18/ 7.45) RDYVpfDGENKWVLRAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.46| 19| 20| 115| 133| 2
---------------------------------------------------------------------------
107- 131 (32.99/17.59) PVidleeaRGTLHFYDYPEPPHPSR
132- 152 (29.47/15.07) PV....nsRLVVHIPDEPKLPSLLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.37| 19| 20| 229| 248| 3
---------------------------------------------------------------------------
229- 248 (27.71/23.21) EGPLLQRGIEElLRVQTDLE
252- 270 (31.67/21.46) EFSVLDRSVLD.TRVPAFLE
---------------------------------------------------------------------------
|