<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01879
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSTPIDSTTNRSYPLSPTPNSEVKRSQPVSFQPRTPQSPLQPNSASSEKVPNNKVSSNMSSTISRTVQGPAMADAHDSATPVTIDSSIQADDLSNKRKREAEDTGDREQKKVHVEERKLCIEDLHLDVGKIYQLCRTPHPYKQPDLSLDLFELYGLNPTAAKVARVLPNGEKNGLRKTYKGKIKDLGISGKFDVTVNDEESSGGLLSMMREPEHEWMVTQRLGKEIEKGLPQSVFAALPAAMTMAKGVIPKQMWDSSVLGELDIPEKKPAAQVPTKPTSVGMQKSGSQQSGAMRGSKADLARPKRAVKKRGYDESSFEGYGEGYVDDDMVDAGYSTGEGDDRGGPGKRRKKSALNQPQYGPSRHGSYGPGMVGA |
Length | 374 |
Position | Head |
Organism | Pseudogymnoascus sp. VKM F-4516 (FW-969) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.828 |
Instability index | 46.31 |
Isoelectric point | 8.89 |
Molecular weight | 40676.24 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01879
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.85| 14| 19| 123| 138| 1
---------------------------------------------------------------------------
123- 138 (21.81/27.29) DLHLDVGKIYQLcrTP
145- 158 (26.04/21.14) DLSLDLFELYGL..NP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.23| 14| 20| 7| 21| 2
---------------------------------------------------------------------------
7- 21 (23.10/15.43) STTNRSyPLSP.TPNS
30- 44 (25.14/11.85) SFQPRT.PQSPlQPNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.77| 18| 18| 57| 74| 3
---------------------------------------------------------------------------
57- 74 (30.17/23.73) SNMSSTISRTVQGPAMAD
78- 95 (28.60/22.09) SATPVTIDSSIQADDLSN
---------------------------------------------------------------------------
|