<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01878

Description Uncharacterized protein
SequenceMPNGGAWRITYSLRDEHSTTAARPAPAPALAERHGHVAEASAAAEPSPAVPAAVAVAGEDERQWCGSDSSRWRGDGVPATRAVEAGSMESPTQAGAAGAVLPLPQRRRPRFPFRRHEAQSDAPKQVGSPQKSSAKLPLPMPARPGRSGVSHVRKQAQEGGNSPKKETRPKPYVLEAPPDAPSYPSNGHLDYFPWTGTHDEDSFNDNVIRQGYFDKPLTGQNEAASAKQQLYPSLRQKNGLQTLGSLFAHVLGQRRQHSQITAAPSFKPPPRVTLTDTKRETWLRDLANPLIPLRRLSRTIPHGIKNKVLLEQCTRKNVPTERAVWLAKCVGANEIRASKRKGVPGALTMGGESKWIRDWTVCVEQFVDGVVTAGGDKDWKSKVLYSIRLSAHLYSEQLLDTEHYLDWLLSSLESTPLTRLPIWLLITEVYWADILRYRKSGRRLVGALCSNLQDAHESPDRDLLLPLIERVGNILTATIRTNPENFIALTNWPKYSDTLLACNSSSEPAEAQIFDAISRRNARLKSRASNCDETQGSRRRVIDLLDASLSVQFSPDLSRECWKAMRDRALLVQTLFDWATSCARPSLMKTFVAARLMRTWSRHGIDVDESVLNYLTFRSNAPGVSSSCVYHLVSELARSGHFSVSKYIQWVIARGGLHGSKDVAPDGPCVTRLLAELPVHDLPESLLRIRKTLLNRASFHVDDETETIDNMSLAFERCSPNLYGKAPSDPEAPTTADVVQNITHLSRTVKAELGLRLRKQINLRMTKASPSDMGEWKTDPEYETATTVTVADFNFTRAVLEATEDLSMLADILKLVSTTSSTQILASIADTLNMHRLTFSAIGALNDLFDTLVARQCSLGVVQGPDSVALLHSLCALSATIPDATNVHVQLSRDVARSVRRSAVDACSPVSDHVAEALQKSDGDISDEVDKLLSSGTSMDAPTLKRLFQVLIGQMEASWAKSDCGLQKLGPILERLRTFDTKQFDNLLSPWVGQTILKTDRPNLSRVLGPLISAGCLSFKDVLKASVSSVQKTRDDGDKPMTSRIAFESLSLVLNTYRDNDIMCIEDAYTLNIKRTQAQFKDHLAILNIARIAIELSEPSVDNSDVTINLLCQGDAFRRFLQRLVLTEFDCVLKEFVAPLAKSQDIHVIYCLRAILRGLLDLKTTTTGPEDLVVARRIEVIFGVASDLTLPFCQLALRSLSASEVPGSNSEGADTSRLEAYERAVDTALANENPTWTKILPTLDPQIAQHLCERAERSLLDAIPAFKPQEGTPPPPIHDAEALAKRMLFVISATAYSTRNPNHTTALEIGEKLNNLAHALSQPYSPDTAVYAQTTIWLPIMLEFITTHASTLSPSRPATDLRARILLALSALLLALHAHVGTHELAEHVLDVSLLLVDELPDDARAQCGRFLADRGKPGGEAVVGDPGLRYVFGLETAADNGGLMLSQRGKMEGFVVRRWENLSEPTPMVGENDAALSLSLFQARRV
Length1487
PositionKinase
OrganismPseudogymnoascus sp. VKM F-4516 (FW-969)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus.
Aromaticity0.06
Grand average of hydropathy-0.249
Instability index44.46
Isoelectric point6.95
Molecular weight163530.22
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01878
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     159.69|      37|      37|      93|     129|       1
---------------------------------------------------------------------------
   38-   64 (35.23/16.40)	.....AEASAAAEP........SP.A..VPAAVA.VAG..E.DERQW
   65-   91 (21.46/ 6.72)	CGS.............dssRWRGD.G..VPATRAvEAG..SmESP..
   92-  125 (57.45/32.02)	...TQAGAAGAVLPLP...QRRRP.R..FPFRRH.EAQ..S.DAPKQ
  126-  165 (45.55/23.66)	VGSPQKSSAK..LPLP...MPARPgRsgVSHVRK.QAQegG.NSPKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     171.25|      40|      40|     932|     971|       2
---------------------------------------------------------------------------
  213-  232 (27.71/12.13)	............FD...KPLTGQNEAASAK......QQ.LYP
  233-  253 (20.82/ 7.25)	SLRQKNGLQT..LGSLFAHVLGQ...................
  932-  971 (68.72/41.12)	LLSSGTSMDAPTLKRLFQVLIGQMEASWAKSD.CGLQK.LGP
  972- 1010 (53.99/30.71)	ILERLRTFDTKQFDNLLSPWVGQ...TILKTDrPNLSRvLGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.51|      35|      39|     834|     868|       3
---------------------------------------------------------------------------
  834-  868 (60.38/33.10)	MHRL.TFSA.IGALNDLFDTL...VARQCSLGVVQGPDSV
  871-  910 (44.13/22.40)	LHSLcALSAtIPDATNVHVQLsrdVARSVRRSAVDACSPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.87|      27|      32|    1303|    1333|       4
---------------------------------------------------------------------------
 1303- 1333 (37.13/35.16)	HTTALEIgekLNNLAHALSqPYSPDTAVYAQ
 1338- 1364 (46.73/29.32)	LPIMLEF...ITTHASTLS.PSRPATDLRAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.30|      31|      37|    1389|    1420|       5
---------------------------------------------------------------------------
 1389- 1420 (50.06/39.35)	VLDVSLLLVDELpDDARAQCGRFLADRGKPGG
 1424- 1454 (56.23/38.64)	VGDPGLRYVFGL.ETAADNGGLMLSQRGKMEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     115.44|      37|      37|    1070|    1106|       6
---------------------------------------------------------------------------
 1070- 1106 (58.70/39.37)	TLNIKRTQAQFKDHLAILNIARIAIELSE...PSVDNSDV
 1107- 1146 (56.75/37.80)	TINLLCQGDAFRRFLQRLVLTEFDCVLKEfvaPLAKSQDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     105.01|      26|      28|     292|     319|       8
---------------------------------------------------------------------------
  294-  319 (47.46/33.50)	RR...LSRTIP.HGIK.NKVLLEQCT.RKNVP
  321-  344 (29.33/11.95)	ERavwLAKCV...G.A.NEI..RASK.RKGVP
  595-  622 (28.22/14.24)	.R...LMRTWSrHGIDvDESVLNYLTfRSNAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.31|      25|      28|    1223|    1250|       9
---------------------------------------------------------------------------
 1223- 1250 (36.15/26.56)	RAvDTALANENPTWTKILPTLDPQIaqH
 1254- 1278 (46.16/23.86)	RA.ERSLLDAIPAFKPQEGTPPPPI..H
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.88|      11|      27|     345|     355|      12
---------------------------------------------------------------------------
  345-  355 (22.06/12.60)	GALTMGGESKW
  369-  379 (21.82/12.39)	GVVTAGGDKDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.76|      17|     174|     274|     291|      13
---------------------------------------------------------------------------
  274-  291 (27.51/20.37)	LTDTkRETWLRDLANPLI
  452-  468 (31.25/18.47)	LQDA.HESPDRDLLLPLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.42|      27|      28|     530|     557|      14
---------------------------------------------------------------------------
  530-  557 (40.90/35.17)	NCDETQGSRRRVID.LLDASLSVQfSPDL
  560-  587 (45.52/33.18)	ECWKAMRDRALLVQtLFDWATSCA.RPSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.12|      32|      67|     657|     691|      15
---------------------------------------------------------------------------
  670-  731 (36.73/20.38)	VTRLLAELPVHDLPESLLRIRKtllnrasfhvddetetidnmslafercspnLYGKAPSDPE
  738-  772 (45.38/18.96)	VVQNITHLSRTVKAELGLRLRK...........................qinLRMTKASPSD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.30|      21|     172|    1026|    1048|      16
---------------------------------------------------------------------------
 1026- 1048 (31.30/26.15)	SVSSVQKTRDDGDKpmTSRI.AFE
 1201- 1222 (32.00/18.72)	SASEVPGSNSEGAD..TSRLeAYE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01878 with Med12 domain of Kingdom Fungi
Unable to open file!