Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MDESTSNSQTFSSADRIRQLNEIDKDIAKLVNSAGLAIQALTNAKNTETTTGNSVAERKAAFKDSTSQYFSLLSSIDVRLRRQVYALEEAGILEAESSTATNVSFKNDTTTTTGTGPGGTGTAAGTFNPLEISWLNSRKDTVGKDKEAESWAAAREFLNRARDTAPQADAMDTDS |
Length | 175 |
Position | Head |
Organism | Talaromyces marneffei PM1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Talaromyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.609 |
Instability index | 22.91 |
Isoelectric point | 4.77 |
Molecular weight | 18767.22 |
Publications | PubMed=25330172 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01866 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 129.96| 45| 61| 6| 52| 1 --------------------------------------------------------------------------- 6- 52 (68.91/47.98) SNSQTF...SSAD.RI.RQLNEIDKdiAKLVNSAGLAIQALTNAKNTETTTG 65- 114 (61.05/36.49) STSQYFsllSSIDvRLrRQVYALEE..AGILEAESSTATNVSFKNDTTTTTG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KDKEAESWAAAREFLNRARDTAPQADAMDTD 2) TFNPLEISWLNSRKDTV | 144 126 | 174 142 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab