<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01858
Description |
Serine/threonine-protein kinase ssn3 |
Sequence | MFGKNYSFLNSLGGSYHRDSGRSGSGYTSKVHIRERYHIVGFISSGTYGRVYKALGKNGKKGEFAIKKFKPDKEGELIQYTGLSQSAIREMALCSELNHPNVVGLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQQQRYAIPAKMVRSILFQLLNGLLYLHTNWVLHRDLKPANILVTASGAIRIGDLGLARLFYKPLNSLFTGDKVVVTIWYRAPELLLGSRHYTPAVDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEILGFPRQETWPGLAAMPEFNQMQSMMQSMKMSSRGALHYNKPSGLDTWYQGCLKTGGYSASSSVGTPGADGFDLLSRLLEYDPAKRITAEEALEHPYFTNGGPISANCFEGCETTYPPRRVSQEGNDIRSGSLPGTKRSGLPDDSLMGRVAKRLKE |
Length | 429 |
Position | Kinase |
Organism | Talaromyces marneffei PM1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces>
Talaromyces sect. Talaromyces.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.313 |
Instability index | 40.24 |
Isoelectric point | 9.13 |
Molecular weight | 48094.77 |
Publications | PubMed=25330172
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01858
No repeats found
|