<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01839
Description |
Mediator of RNA polymerase II transcription subunit 30 (Fragment) |
Sequence | MSTPPLAGAGMPPGAFSGTQSQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHTATYQDRLGKLQEHLRQLSILFRKLRLVYDKCNENCAGLDPVPIEQLIPYVEEDGSKHDDRGAASQLRFASEERREIMEVNK |
Length | 148 |
Position | Head |
Organism | Manacus vitellinus (golden-collared manakin) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Pipridae> Manacus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.474 |
Instability index | 53.93 |
Isoelectric point | 5.92 |
Molecular weight | 16664.77 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01839
No repeats found
No repeats found
|