| Description | Mediator of RNA polymerase II transcription subunit 28 (Fragment) |
| Sequence | QACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLSKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
| Length | 126 |
| Position | Head |
| Organism | Manacus vitellinus (golden-collared manakin) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Pipridae> Manacus. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.622 |
| Instability index | 62.83 |
| Isoelectric point | 6.34 |
| Molecular weight | 14530.43 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP01836 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) GPLAYLE 2) LQRKEALIQKHLSKLRHW | 107 70 | 113 87 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab