Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | GTTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDSSSLRSLIEKPPICGSSFTPLTGAMLTGFRLHAGPKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRPSPEHPGMGSSQASSS |
Length | 154 |
Position | Head |
Organism | Manacus vitellinus (golden-collared manakin) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Passeriformes> Pipridae> Manacus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.300 |
Instability index | 61.88 |
Isoelectric point | 9.92 |
Molecular weight | 17149.38 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01829 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 77.00| 17| 18| 107| 123| 1 --------------------------------------------------------------------------- 86- 104 (24.79/10.26) PKKNKHKHKQSRTQDpvPP 107- 123 (29.92/13.76) PSDSDHKKKKKKKEE..DP 126- 139 (22.28/ 8.55) KR...KKKEKKKKKN..RP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRPS 2) LTGFRLHAGPKKNKHKHK | 109 77 | 140 94 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab