<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01824
| Description |
Mediator of RNA polymerase II transcription subunit 20 (Fragment) |
| Sequence | YHTAWAIGTQGQTGKLMYVMHNSEYPLSCFALFENGPCLVADANFDTLMVKLKGFFQNAKANKIESRGTRYQYCDFLVKLGTVTMGPSARGISVEVEYCPCVIANDCWNLLMEFMQSFMGSHTPGIPSVFGAKHDSVYSPGDTMVQYMELFNKIRKQQQVPVAGIR |
| Length | 166 |
| Position | Head |
| Organism | Manacus vitellinus (golden-collared manakin) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Passeriformes> Pipridae> Manacus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.075 |
| Instability index | 31.37 |
| Isoelectric point | 7.76 |
| Molecular weight | 18574.27 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01824
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.79| 10| 32| 85| 94| 1
---------------------------------------------------------------------------
85- 94 (19.65/12.05) MGPSARGI.SV
119- 129 (16.14/ 8.88) MGSHTPGIpSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.07| 22| 61| 34| 55| 2
---------------------------------------------------------------------------
34- 55 (39.70/20.32) ENGPCLVADANFDTLMVKLKGF
97- 118 (45.37/23.90) EYCPCVIANDCWNLLMEFMQSF
---------------------------------------------------------------------------
|