<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01816
Description |
Mediator of RNA polymerase II transcription subunit 20 (Fragment) |
Sequence | GQTGKLMYVMHNSEYPLSCFALFESGPCLVADANFDILMVKLKGFFQNAKANKIESRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYCPCVIANDCWNLLMEFMQSFMGSHTPGIPSVFSTKHDSIYSPADTMVQYMELFNKIRKQQQVPVAGIR |
Length | 156 |
Position | Head |
Organism | Dryobates pubescens (Downy woodpecker) (Picoides pubescens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.013 |
Instability index | 40.00 |
Isoelectric point | 7.75 |
Molecular weight | 17504.15 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364134
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01816
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.71| 22| 61| 24| 45| 2
---------------------------------------------------------------------------
24- 45 (39.28/25.87) ESGPCLVADANFDILMVKLKGF
87- 108 (45.43/30.86) EYCPCVIANDCWNLLMEFMQSF
---------------------------------------------------------------------------
|