<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01815
| Description |
Transcription elongation factor A protein 3 (Fragment) |
| Sequence | GALDLLKSLTGYTMTIQLLQATRIGVAVNSVRKHCEDEEVVASAKILIRNWKRLLAGPARRDSADSRSSSTSAASSPRKRPSGDRANGSKAKPEAPQTPTSPSFSPGPCLLAPCYLTGDSVRDKCIEMLAAALRVDDDYKEFGVNCEQMASEIEDHILWGAWGPPHIFQELKSTDMKYRNRVRSRISNLKDPKNPSLRRGVLCWDTQPSLIARMTAEHQMAKTGGTVTDLFQCGKCRKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKVC |
| Length | 271 |
| Position | Unknown |
| Organism | Dryobates pubescens (Downy woodpecker) (Picoides pubescens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.538 |
| Instability index | 53.91 |
| Isoelectric point | 9.16 |
| Molecular weight | 30024.99 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01815
No repeats found
|