<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01811
| Description |
Cyclin-dependent kinase 19 (Fragment) |
| Sequence | KDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDK |
| Length | 327 |
| Position | Kinase |
| Organism | Dryobates pubescens (Downy woodpecker) (Picoides pubescens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.440 |
| Instability index | 48.83 |
| Isoelectric point | 7.83 |
| Molecular weight | 38113.67 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP01811
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 36| 108| 122| 3
---------------------------------------------------------------------------
108- 122 (26.77/22.04) DLKPANILVMGEGPE
146- 160 (28.67/24.14) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
|