<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01797
Description |
Cyclin-dependent kinase 19 (Fragment) |
Sequence | CVSLQLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKGDKQNSTQTNGTAGGAGAGGGGAGTGLQHSQDSSLNQVPPTKKPRIGPSGANSGGPVMPSDYQ |
Length | 367 |
Position | Kinase |
Organism | Struthio camelus australis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Palaeognathae> Struthioniformes> Struthionidae>
Struthio.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.477 |
Instability index | 46.47 |
Isoelectric point | 8.49 |
Molecular weight | 41580.19 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP01797
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.03| 21| 41| 284| 304| 1
---------------------------------------------------------------------------
284- 304 (38.72/21.19) AGCQIPYPKREFLNEDEPEEK
327- 347 (36.31/19.50) AGTGLQHSQDSSLNQVPPTKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 41| 88| 102| 2
---------------------------------------------------------------------------
88- 102 (26.77/20.39) DLKPANILVMGEGPE
126- 140 (28.67/22.36) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.64| 27| 40| 214| 246| 3
---------------------------------------------------------------------------
214- 246 (37.66/52.52) PTlqkdfRRTTYANSSLIKYMEKHKVkPDSKVF
257- 283 (48.98/42.18) PT.....KRITSEQALQDPYFQEDPL.PTSDVF
---------------------------------------------------------------------------
|