<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01779
| Description |
Mediator of RNA polymerase II transcription subunit 1 (Fragment) |
| Sequence | ISTNDLMEQLRLKYQQKTWAETLKLVHFCMDKPLRQPVSNAPDGPFRSCLEKIQRTLNAKSLFSMMNRLESLSKQKGLNAHVSPTGTTCYITSNMFYIEVQLEKDGEVVDVKLAHLGEAPVVCDDLVQHLRMKNYDAFGNILEDLSNLYQTPGNSEMKAKGYLALQALEKDIYSMSLLDRVQDVNRVTEVLHGKVGHLVPRTGGTPMSIEFYISPYQALEAELNPGSQVCGTKAIVIVEGTDTLHRLSLSPLLVDSQTGEDGNPTFLPLTDELSMEFSAFFVMKFHQPIPMSSSSIEEIQRLTGMLSLFLRLRIQITGLKLAPLYELIVQSTLKEKCSEDLSTHQSCFFVSLPDCPKHCYFINKGSGRSDLAGALVSKIPFSHPKCVPGVIEILRHQVARNTLISSCVSERHINEDDSELLYFEVVPHKNSSFSVFFLHPVKENLACVAIDVIASREVRCHLHLNPQDPTLNSSDDFIARALMRCMSVPLLMRAIFRNAAKVKANS |
| Length | 506 |
| Position | Middle |
| Organism | Dryobates pubescens (Downy woodpecker) (Picoides pubescens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.098 |
| Instability index | 44.95 |
| Isoelectric point | 6.40 |
| Molecular weight | 56647.81 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01779
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.92| 12| 65| 271| 282| 1
---------------------------------------------------------------------------
271- 282 (22.16/15.58) DELSMEFSAFFV
339- 350 (23.76/17.27) EDLSTHQSCFFV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 147.37| 46| 48| 131| 176| 8
---------------------------------------------------------------------------
131- 176 (77.86/53.41) RMKNYDAFGNILE.DLSNLYQTPGNSEMKAKGYLA.LQALEKDIYSMS
180- 227 (69.51/46.95) RVQDVNRVTEVLHgKVGHLVPRTGGTPMSIEFYISpYQALEAELNPGS
---------------------------------------------------------------------------
|