<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01774

Description Transcription elongation factor A protein 2 (Fragment)
SequenceGAMDLLKELKSMPMTLDLLQSTRIGMSVNALRKQSTDEEVIALAKSLIKSWKKLLDASEEKSEERKRSLSLPTSSSKETSNSRDQSFSFSSNKRQEPPKTPTTPKITTFPPAPVTCDAVRNKCREMLTAALQADDDYVAIGADWPSSGCRLLDCPERIYQDVKNTDMKYKNRVRSRISNLKDSKNPELKKNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWK
Length281
PositionUnknown
OrganismDryobates pubescens (Downy woodpecker) (Picoides pubescens)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides.
Aromaticity0.04
Grand average of hydropathy-0.741
Instability index55.04
Isoelectric point9.07
Molecular weight31564.82
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
translation elongation factor activity	GO:0003746	IEA:UniProtKB-KW
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP01774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     223.97|      66|     151|      57|     123|       1
---------------------------------------------------------------------------
   57-  123 (108.65/55.81)	ASEEKSEERKRSLSLPTSSSKETSNSRDQSFSFSSNKRQEPPKTPTTPKiTTFPPAPVTCDAVRNKC
  211-  276 (115.32/56.16)	ASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQ.TRSSDEPMTTFVVCNEC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP01774 with Med26 domain of Kingdom Metazoa
Unable to open file!