Description | Mediator of RNA polymerase II transcription subunit 19 (Fragment) |
Sequence | LITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICSSSFPPLTGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
Length | 162 |
Position | Head |
Organism | Dryobates pubescens (Downy woodpecker) (Picoides pubescens) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.303 |
Instability index | 74.75 |
Isoelectric point | 10.01 |
Molecular weight | 18393.99 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP01773 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.46| 16| 16| 108| 123| 1 --------------------------------------------------------------------------- 89- 104 (26.45/11.66) PKKKNKHKHKQSRTQD 108- 123 (26.61/11.78) PETPSDSDHKKKKKKK 127- 142 (26.40/11.63) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LMHIQPPKKKNKHKHKQS 2) SDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHP | 83 114 | 100 148 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab