<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01769
| Description |
Cyclin-C (Fragment) |
| Sequence | LQWILDKQDLLKERQKDLKFLTEEEYWKLKTFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 272 |
| Position | Kinase |
| Organism | Dryobates pubescens (Downy woodpecker) (Picoides pubescens) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Piciformes> Picidae> Picoides.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.165 |
| Instability index | 47.00 |
| Isoelectric point | 7.68 |
| Molecular weight | 31950.96 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP01769
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 204| 217| 1
---------------------------------------------------------------------------
204- 217 (20.63/18.51) QW..FAELSvDMEKIL
229- 243 (20.73/13.09) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|