<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP01735
Description |
Cyclin-C (Fragment) |
Sequence | LQWILDKQDLLKERQKDLKFLTEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
Length | 272 |
Position | Kinase |
Organism | Nipponia nippon (Crested ibis) (Ibis nippon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Pelecaniformes> Threskiornithidae>
Nipponia.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.144 |
Instability index | 48.06 |
Isoelectric point | 7.05 |
Molecular weight | 31962.97 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP01735
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 204| 217| 1
---------------------------------------------------------------------------
204- 217 (20.63/18.58) QW..FAELSvDMEKIL
229- 243 (20.73/13.13) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|